Lineage for d2f8ng1 (2f8n G:1014-1119)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 764835Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 764836Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 764837Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
    form octamers composed of two copies of each of the four histones
  6. 765160Protein macro-H2A.1, histone domain [140396] (1 species)
  7. 765161Species Human (Homo sapiens) [TaxId:9606] [140397] (2 PDB entries)
    Uniprot O75367 11-116
  8. 765164Domain d2f8ng1: 2f8n G:1014-1119 [133138]
    Other proteins in same PDB: d2f8na1, d2f8nb1, d2f8nd1, d2f8ne1, d2f8nf1, d2f8nh1, d2f8nk1
    automatically matched to 1U35 C:814-919

Details for d2f8ng1

PDB Entry: 2f8n (more details), 2.9 Å

PDB Description: 2.9 Angstrom X-ray structure of hybrid macroH2A nucleosomes
PDB Compounds: (G:) Core histone macro-H2A.1

SCOP Domain Sequences for d2f8ng1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8ng1 a.22.1.1 (G:1014-1119) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]}
ktsrsakagvifpvgrmlryikkghpkyrigvgapvymaavleyltaeilelavnaardn
kkgrvtprhillavandeelnqllkgvtiasggvlpnihpellakk

SCOP Domain Coordinates for d2f8ng1:

Click to download the PDB-style file with coordinates for d2f8ng1.
(The format of our PDB-style files is described here.)

Timeline for d2f8ng1: