Lineage for d2f8nf1 (2f8n F:224-302)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637441Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 637442Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 637443Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
    form octamers composed of two copies of each of the four histones
  6. 637645Protein Histone H4 [47125] (4 species)
  7. 637646Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (28 PDB entries)
  8. 637695Domain d2f8nf1: 2f8n F:224-302 [133137]
    Other proteins in same PDB: d2f8na1, d2f8nd1, d2f8ne1, d2f8ng1, d2f8nh1
    automatically matched to d1p3ob_

Details for d2f8nf1

PDB Entry: 2f8n (more details), 2.9 Å

PDB Description: 2.9 Angstrom X-ray structure of hybrid macroH2A nucleosomes
PDB Compounds: (F:) histone h4

SCOP Domain Sequences for d2f8nf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8nf1 a.22.1.1 (F:224-302) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
mdvvyalkrqgrtlygfgg

SCOP Domain Coordinates for d2f8nf1:

Click to download the PDB-style file with coordinates for d2f8nf1.
(The format of our PDB-style files is described here.)

Timeline for d2f8nf1: