SCOP 1.75: Domain d2f8na1: 2f8n A:438-535

Lineage for d2f8na1 (2f8n A:438-535)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H3 [47122] (5 species)

7. Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47123] (7 PDB entries)
   Uniprot P84229

8. Domain d2f8na1: 2f8n A:438-535 [133133]
   Other proteins in same PDB: d2f8nb1, d2f8nd1, d2f8nf1, d2f8ng1, d2f8nh1, d2f8nk1
   automatically matched to d1eqzc_

Details for d2f8na1

PDB Entry: 2f8n, 2.9 Å

PDB Description: 2.9 Angstrom X-ray structure of hybrid macroH2A nucleosomes

PDB Compounds: (A:) Histone H3.1

SCOP Domain Sequences for d2f8na1:

Sequence; same for both SEQRES and ATOM records:

>d2f8na1 a.22.1.1 (A:438-535) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
aylvglfedtnlcaihakrvtimpkdiqlarrirgera

Timeline for d2f8na1:

• d2f8na1 first appeared in SCOP 1.73
  
• d2f8na1 is called d2f8na_ in SCOPe 2.01
  
• d2f8na1 appears in the current release, SCOPe 2.08, called d2f8na_