Lineage for d2f8la1 (2f8l A:2-329)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130341Family c.66.1.45: N-6 DNA Methylase-like [142606] (3 protein domains)
    Pfam PF02384; contains C-terminal extension to the canonical fold and extra N-terminal all-alpha domain similar to the insert domain of the DAM family (88788)
  6. 2130342Protein Hypothetical protein Lmo1582 [142607] (1 species)
  7. 2130343Species Listeria monocytogenes [TaxId:1639] [142608] (1 PDB entry)
    Uniprot Q8Y6U9 2-329
  8. 2130344Domain d2f8la1: 2f8l A:2-329 [133132]
    complexed with cl, gol, sam, so4

Details for d2f8la1

PDB Entry: 2f8l (more details), 2.2 Å

PDB Description: crystal structure of a putative class i s-adenosylmethionine-dependent methyltransferase (lmo1582) from listeria monocytogenes at 2.20 a resolution
PDB Compounds: (A:) hypothetical protein lmo1582

SCOPe Domain Sequences for d2f8la1:

Sequence, based on SEQRES records: (download)

>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]}
aneatqelfqvldntaiilqneleisyleavyetgenlfqkevlqkeelssekqlklqas
yesielenfsneeirkglqlallkgmkhgiqvnhqmtpdsigfivayllekviqkkknvs
ildpacgtanllttvinqlelkgdvdvhasgvdvddllislalvgadlqrqkmtllhqdg
lanllvdpvdvvisdlpvgyypddenaktfelcreeghsfahflfieqgmrytkpggylf
flvpdamfgtsdfakvdkfikknghiegiiklpetlfkseqarksililekadvdvkppk
evllanlssltdpsvtapilaeienwfk

Sequence, based on observed residues (ATOM records): (download)

>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]}
aneatqelfqvldntaiilqneleisyleavyetgenlfqkevlqkeekqlklqasyesi
elenfsneeirkglqlallkgmkhgiqvnhqmtpdsigfivayllekviqkkknvsildp
acgtanllttvinqlelkgdvdvhasgvdvddllislalvgadlqrqkmtllhqdglanl
lvdpvdvvisdlpvgyypddenaktfelcreeghsfahflfieqgmrytkpggylfflvp
damfgtsdfakvdkfikknghiegiiklpetlfksqarksililekadvdvkppkevlla
nlssltdpsvtapilaeienwfk

SCOPe Domain Coordinates for d2f8la1:

Click to download the PDB-style file with coordinates for d2f8la1.
(The format of our PDB-style files is described here.)

Timeline for d2f8la1: