Lineage for d2f8jc1 (2f8j C:1-334)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 705327Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 705328Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) (S)
  5. 705329Family c.67.1.1: AAT-like [53384] (16 proteins)
  6. 705553Protein Histidinol-phosphate aminotransferase HisC [64121] (2 species)
  7. 705561Species Thermotoga maritima [TaxId:2336] [102594] (5 PDB entries)
    TM1040
  8. 705564Domain d2f8jc1: 2f8j C:1-334 [133130]
    automatically matched to d1uu1b_
    complexed with edo, pmp

Details for d2f8jc1

PDB Entry: 2f8j (more details), 2.4 Å

PDB Description: Crystal structure of Histidinol-phosphate aminotransferase (EC 2.6.1.9) (Imidazole acetol-phosphate transferase) (tm1040) from Thermotoga maritima at 2.40 A resolution
PDB Compounds: (C:) Histidinol-phosphate aminotransferase

SCOP Domain Sequences for d2f8jc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8jc1 c.67.1.1 (C:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]}
mnpldliakraypyetekrdktylalnenpfpfpedlvdevfrrlnsdalriyydspdee
liekilsyldtdflsknnvsvgngadeiiyvmmlmfdrsvffpptyscyrifakavgakf
levpltkdlripevnvgegdvvfipnpnnptghvfereeierilktgafvaldeayyefh
gesyvdflkkyenlavirtfskafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmf
akvaldhreifeertkfiveerermksalremgyritdsrgnfvfvfmekeekerllehl
rtknvavrsfregvritigkreendmilrelevf

SCOP Domain Coordinates for d2f8jc1:

Click to download the PDB-style file with coordinates for d2f8jc1.
(The format of our PDB-style files is described here.)

Timeline for d2f8jc1: