Lineage for d2f8jb_ (2f8j B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2895168Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 2895446Protein Histidinol-phosphate aminotransferase HisC [64121] (2 species)
  7. 2895454Species Thermotoga maritima [TaxId:2336] [102594] (5 PDB entries)
    Uniprot Q9X0D0
    TM1040
  8. 2895456Domain d2f8jb_: 2f8j B: [133129]
    Other proteins in same PDB: d2f8ja3
    automated match to d1uu1b_
    complexed with edo, pmp

Details for d2f8jb_

PDB Entry: 2f8j (more details), 2.4 Å

PDB Description: Crystal structure of Histidinol-phosphate aminotransferase (EC 2.6.1.9) (Imidazole acetol-phosphate transferase) (tm1040) from Thermotoga maritima at 2.40 A resolution
PDB Compounds: (B:) Histidinol-phosphate aminotransferase

SCOPe Domain Sequences for d2f8jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8jb_ c.67.1.1 (B:) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]}
npldliakraypyetekrdktylalnenpfpfpedlvdevfrrlnsdalriyydspdeel
iekilsyldtdflsknnvsvgngadeiiyvmmlmfdrsvffpptyscyrifakavgakfl
evpltkdlripevnvgegdvvfipnpnnptghvfereeierilktgafvaldeayyefhg
esyvdflkkyenlavirtfskafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmfa
kvaldhreifeertkfiveerermksalremgyritdsrgnfvfvfmekeekerllehlr
tknvavrsfregvritigkreendmilrelevf

SCOPe Domain Coordinates for d2f8jb_:

Click to download the PDB-style file with coordinates for d2f8jb_.
(The format of our PDB-style files is described here.)

Timeline for d2f8jb_: