SCOP 1.73: Domain d2f8ib1: 2f8i B:10-123

Lineage for d2f8ib1 (2f8i B:10-123)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (1 family)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (1 protein)

6. Protein Transthyretin (synonym: prealbumin) [49474] (4 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (67 PDB entries)

8. Domain d2f8ib1: 2f8i B:10-123 [133127]
   automatically matched to d1bzda_
   complexed with 205

Details for d2f8ib1

PDB Entry: 2f8i, 1.54 Å

PDB Description: human transthyretin (ttr) complexed with benzoxazole

PDB Compounds: (B:) Transthyretin

SCOP Domain Sequences for d2f8ib1:

Sequence, based on SEQRES records:

>d2f8ib1 b.3.4.1 (B:10-123) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvt

Sequence, based on observed residues (ATOM records):

>d2f8ib1 b.3.4.1 (B:10-123) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandrytiaallspysysttavvt

Timeline for d2f8ib1:

• d2f8ib1 is new in SCOP 1.73
  
• d2f8ib1 appears in SCOP 1.75
  
• d2f8ib1 appears in the current release, SCOPe 2.08, called d2f8ib_