Lineage for d2f8ib_ (2f8i B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
    automatically mapped to Pfam PF00576
  6. Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. Species Human (Homo sapiens) [TaxId:9606] [49475] (320 PDB entries)
    Uniprot P02766 31-143
  8. Domain d2f8ib_: 2f8i B: [133127]
    automated match to d1eta1_
    complexed with 205

Details for d2f8ib_

PDB Entry: 2f8i (more details), 1.54 Å

PDB Description: human transthyretin (ttr) complexed with benzoxazole
PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d2f8ib_:

Sequence, based on SEQRES records: (download)

>d2f8ib_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvt

Sequence, based on observed residues (ATOM records): (download)

>d2f8ib_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandrytiaallspysysttavvt

SCOPe Domain Coordinates for d2f8ib_ are not available.

Timeline for d2f8ib_:

Domains from other chains:
(mouse over for more information)
d2f8ia_