Lineage for d2f8fb2 (2f8f B:4-84)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1168419Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 1168430Protein Class alpha GST [81360] (8 species)
  7. 1168431Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [89704] (8 PDB entries)
  8. 1168440Domain d2f8fb2: 2f8f B:4-84 [133125]
    Other proteins in same PDB: d2f8fa1, d2f8fb1
    automatically matched to d1oe8b2
    complexed with gsh; mutant

Details for d2f8fb2

PDB Entry: 2f8f (more details), 2.1 Å

PDB Description: crystal structure of the y10f mutant of the gluathione s-transferase from schistosoma haematobium
PDB Compounds: (B:) glutathione s-transferase 28 kda

SCOPe Domain Sequences for d2f8fb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8fb2 c.47.1.5 (B:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]}
dhikviffngrgraesirmtlvaagvnyederisfqdwpkikptipggrlpavkitdnhg
hvkwmveslaiarymakkhhm

SCOPe Domain Coordinates for d2f8fb2:

Click to download the PDB-style file with coordinates for d2f8fb2.
(The format of our PDB-style files is described here.)

Timeline for d2f8fb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f8fb1