Lineage for d2f8fb1 (2f8f B:85-205)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 769705Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 769706Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 769707Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 769718Protein Class alpha GST [81349] (8 species)
  7. 769719Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [89060] (8 PDB entries)
  8. 769730Domain d2f8fb1: 2f8f B:85-205 [133124]
    Other proteins in same PDB: d2f8fa2, d2f8fb2
    automatically matched to d1oe7a1
    complexed with gtt; mutant

Details for d2f8fb1

PDB Entry: 2f8f (more details), 2.1 Å

PDB Description: Crystal structure of the Y10F mutant of the gluathione s-transferase from schistosoma haematobium
PDB Compounds: (B:) glutathione s-transferase 28 kda

SCOP Domain Sequences for d2f8fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8fb1 a.45.1.1 (B:85-205) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]}
mggteeeyynvekligqaedleheyyktlmkpeeekqkiikeilngkvpvlldiiceslk
astgklavgdkvtladlvliavidhvtdldkefltgkypeihkhrenllassprlakyls
d

SCOP Domain Coordinates for d2f8fb1:

Click to download the PDB-style file with coordinates for d2f8fb1.
(The format of our PDB-style files is described here.)

Timeline for d2f8fb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f8fb2