Class a: All alpha proteins [46456] (286 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein automated matches [226848] (11 species) not a true protein |
Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [225081] (4 PDB entries) |
Domain d2f8fa1: 2f8f A:85-206 [133122] Other proteins in same PDB: d2f8fa2, d2f8fb2 automated match to d1u3ia2 complexed with gsh; mutant |
PDB Entry: 2f8f (more details), 2.1 Å
SCOPe Domain Sequences for d2f8fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f8fa1 a.45.1.1 (A:85-206) automated matches {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} mggteeeyynvekligqaedleheyyktlmkpeeekqkiikeilngkvpvlldiiceslk astgklavgdkvtladlvliavidhvtdldkefltgkypeihkhrenllassprlakyls dr
Timeline for d2f8fa1: