SCOPe 2.08: Domain d2f8ex2: 2f8e X:1-470

Lineage for d2f8ex2 (2f8e X:1-470)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)

6. Protein Viral RNA polymerase [56695] (17 species)

7. Species Foot-and-mouth disease virus - type c [TaxId:12116] [187085] (9 PDB entries)

8. Domain d2f8ex2: 2f8e X:1-470 [133121]
   Other proteins in same PDB: d2f8ex3
   automated match to d1u09a_
   protein/RNA complex; complexed with mg, mn, u5p
   missing some secondary structures that made up less than one-third of the common domain

Details for d2f8ex2

PDB Entry: 2f8e, 2.9 Å

PDB Description: Foot and Mouth Disease Virus RNA-dependent RNA polymerase in complex with uridylylated VPg protein

PDB Compounds: (X:) RNA-dpendent RNA polymerase

SCOPe Domain Sequences for d2f8ex2:

Sequence; same for both SEQRES and ATOM records:

>d2f8ex2 e.8.1.4 (X:1-470) Viral RNA polymerase {Foot-and-mouth disease virus - type c [TaxId: 12116]}
glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdprlnegvvldevifskh
kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp
walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekvragktri
vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd
ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggmpsgc
satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl
gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti
qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgda

Timeline for d2f8ex2:

• d2f8ex2 first appeared in SCOP 1.73, called d2f8ex1
  
• d2f8ex2 appears in SCOPe 2.07