Class b: All beta proteins [48724] (165 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (2 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein Human immunodeficiency virus type 1 protease [50632] (1 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (230 PDB entries) |
Domain d2f81b1: 2f81 B:101-199 [133117] automatically matched to d1dw6c_ complexed with 017, cl, gol, na; mutant |
PDB Entry: 2f81 (more details), 1.25 Å
SCOP Domain Sequences for d2f81b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f81b1 b.50.1.1 (B:101-199) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd qiiieiaghkaigtvlvgptpvniigrnlmtqigatlnf
Timeline for d2f81b1: