SCOPe 2.05: Domain d2f7yc_: 2f7y C:

Lineage for d2f7yc_ (2f7y C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families)

5. Family c.57.1.0: automated matches [191349] (1 protein)
   not a true family

6. Protein automated matches [190284] (9 species)
   not a true protein

7. Species Shewanella oneidensis [TaxId:70863] [187084] (2 PDB entries)

8. Domain d2f7yc_: 2f7y C: [133112]
   automated match to d1di6a_

Details for d2f7yc_

PDB Entry: 2f7y, 2.3 Å

PDB Description: Crystal structure of Molybdenum cofactor biosynthesis protein Mog from Shewanella oneidensis

PDB Compounds: (C:) molybdenum cofactor biosynthesis protein Mog

SCOPe Domain Sequences for d2f7yc_:

Sequence; same for both SEQRES and ATOM records:

>d2f7yc_ c.57.1.0 (C:) automated matches {Shewanella oneidensis [TaxId: 70863]}
akigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlikmad
eqdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqtagl
rgdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfrp

Timeline for d2f7yc_:

• d2f7yc_ first appeared in SCOP 1.73, called d2f7yc1
  
• d2f7yc_ appears in SCOPe 2.04
  
• d2f7yc_ appears in SCOPe 2.06
  
• d2f7yc_ appears in the current release, SCOPe 2.08