Lineage for d2f7yb_ (2f7y B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 998094Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 998095Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 998224Family c.57.1.0: automated matches [191349] (1 protein)
    not a true family
  6. 998225Protein automated matches [190284] (2 species)
    not a true protein
  7. 998226Species Shewanella oneidensis [TaxId:70863] [187084] (2 PDB entries)
  8. 998230Domain d2f7yb_: 2f7y B: [133111]
    automated match to d1di6a_

Details for d2f7yb_

PDB Entry: 2f7y (more details), 2.3 Å

PDB Description: Crystal structure of Molybdenum cofactor biosynthesis protein Mog from Shewanella oneidensis
PDB Compounds: (B:) molybdenum cofactor biosynthesis protein Mog

SCOPe Domain Sequences for d2f7yb_:

Sequence, based on SEQRES records: (download)

>d2f7yb_ c.57.1.0 (B:) automated matches {Shewanella oneidensis [TaxId: 70863]}
kigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlikmade
qdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqtaglr
gdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfrp

Sequence, based on observed residues (ATOM records): (download)

>d2f7yb_ c.57.1.0 (B:) automated matches {Shewanella oneidensis [TaxId: 70863]}
kigivtvsdragiyedisgkaiidtlndyltsewepiyqvipdeqdviettlikmadeqd
cclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqtaglrgd
slivnlpgkpksirecldavfpaipycidlmegpylecneavikpfrp

SCOPe Domain Coordinates for d2f7yb_:

Click to download the PDB-style file with coordinates for d2f7yb_.
(The format of our PDB-style files is described here.)

Timeline for d2f7yb_: