Lineage for d2f7wc1 (2f7w C:2-174)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 703405Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 703406Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families) (S)
  5. 703407Family c.57.1.1: MogA-like [53219] (5 proteins)
  6. 703425Protein MogA [53220] (2 species)
  7. 703429Species Shewanella oneidensis [TaxId:70863] [142541] (3 PDB entries)
  8. 703432Domain d2f7wc1: 2f7w C:2-174 [133108]
    automatically matched to 2F7W A:2-174

Details for d2f7wc1

PDB Entry: 2f7w (more details), 1.9 Å

PDB Description: Crystal structure of Molybdenum cofactor biosynthesis protein Mog from Shewanella oneidensis
PDB Compounds: (C:) molybdenum cofactor biosynthesis protein Mog

SCOP Domain Sequences for d2f7wc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f7wc1 c.57.1.1 (C:2-174) MogA {Shewanella oneidensis [TaxId: 70863]}
skakigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlikm
adeqdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqta
glrgdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfrp

SCOP Domain Coordinates for d2f7wc1:

Click to download the PDB-style file with coordinates for d2f7wc1.
(The format of our PDB-style files is described here.)

Timeline for d2f7wc1: