Lineage for d2f7wc_ (2f7w C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890089Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 2890090Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 2890232Family c.57.1.0: automated matches [191349] (1 protein)
    not a true family
  6. 2890233Protein automated matches [190284] (9 species)
    not a true protein
  7. 2890262Species Shewanella oneidensis [TaxId:70863] [187084] (2 PDB entries)
  8. 2890264Domain d2f7wc_: 2f7w C: [133108]
    Other proteins in same PDB: d2f7wa1
    automated match to d1di6a_

Details for d2f7wc_

PDB Entry: 2f7w (more details), 1.9 Å

PDB Description: Crystal structure of Molybdenum cofactor biosynthesis protein Mog from Shewanella oneidensis
PDB Compounds: (C:) molybdenum cofactor biosynthesis protein Mog

SCOPe Domain Sequences for d2f7wc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f7wc_ c.57.1.0 (C:) automated matches {Shewanella oneidensis [TaxId: 70863]}
skakigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlikm
adeqdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqta
glrgdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfrp

SCOPe Domain Coordinates for d2f7wc_:

Click to download the PDB-style file with coordinates for d2f7wc_.
(The format of our PDB-style files is described here.)

Timeline for d2f7wc_: