| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold |
Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) ![]() |
| Family c.57.1.1: MogA-like [53219] (6 proteins) |
| Protein MogA [53220] (3 species) |
| Species Shewanella oneidensis [TaxId:70863] [142541] (2 PDB entries) Uniprot Q8EKM7 2-174 |
| Domain d2f7wa1: 2f7w A:2-174 [133106] Other proteins in same PDB: d2f7wb_, d2f7wc_ |
PDB Entry: 2f7w (more details), 1.9 Å
SCOPe Domain Sequences for d2f7wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f7wa1 c.57.1.1 (A:2-174) MogA {Shewanella oneidensis [TaxId: 70863]}
skakigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlikm
adeqdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqta
glrgdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfrp
Timeline for d2f7wa1: