Lineage for d2f7wa1 (2f7w A:2-174)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890089Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 2890090Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 2890091Family c.57.1.1: MogA-like [53219] (6 proteins)
  6. 2890109Protein MogA [53220] (3 species)
  7. 2890120Species Shewanella oneidensis [TaxId:70863] [142541] (3 PDB entries)
    Uniprot Q8EKM7 2-174
  8. 2890127Domain d2f7wa1: 2f7w A:2-174 [133106]
    Other proteins in same PDB: d2f7wb_, d2f7wc_

Details for d2f7wa1

PDB Entry: 2f7w (more details), 1.9 Å

PDB Description: Crystal structure of Molybdenum cofactor biosynthesis protein Mog from Shewanella oneidensis
PDB Compounds: (A:) molybdenum cofactor biosynthesis protein Mog

SCOPe Domain Sequences for d2f7wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f7wa1 c.57.1.1 (A:2-174) MogA {Shewanella oneidensis [TaxId: 70863]}
skakigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlikm
adeqdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqta
glrgdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfrp

SCOPe Domain Coordinates for d2f7wa1:

Click to download the PDB-style file with coordinates for d2f7wa1.
(The format of our PDB-style files is described here.)

Timeline for d2f7wa1: