Lineage for d2f7sa1 (2f7s A:5-190)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987698Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 988206Protein Rab27b [142263] (1 species)
  7. 988207Species Human (Homo sapiens) [TaxId:9606] [142264] (1 PDB entry)
    Uniprot O00194 4-189
  8. 988208Domain d2f7sa1: 2f7s A:5-190 [133104]
    complexed with gdp, mg

Details for d2f7sa1

PDB Entry: 2f7s (more details), 2.7 Å

PDB Description: The crystal structure of human Rab27b bound to GDP
PDB Compounds: (A:) Ras-related protein Rab-27B

SCOPe Domain Sequences for d2f7sa1:

Sequence, based on SEQRES records: (download)

>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]}
dydylikllalgdsgvgkttflyrytdnkfnpkfittvgidfrekrvvynaqgpngssgk
afkvhlqlwdtagqerfrslttaffrdamgfllmfdltsqqsflnvrnwmsqlqanayce
npdivlignkadlpdqrevnerqareladkygipyfetsaatgqnvekavetlldlimkr
meqcve

Sequence, based on observed residues (ATOM records): (download)

>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]}
dydylikllalgdsgvgkttflyrytdnkfnpkfittvgidfrekrvvynagkafkvhlq
lwdtagqerfrslttaffrdamgfllmfdltsqqsflnvrnwmsqlqanaycenpdivli
gnkadlpdqrevnerqareladkygipyfetsaatgqnvekavetlldlimkrmeqcve

SCOPe Domain Coordinates for d2f7sa1:

Click to download the PDB-style file with coordinates for d2f7sa1.
(The format of our PDB-style files is described here.)

Timeline for d2f7sa1: