SCOPe 2.08: Domain d2f7fa1: 2f7f A:141-485

Lineage for d2f7fa1 (2f7f A:141-485)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families)
   incomplete beta/alpha barrel with parallel beta-sheet of 7 strands

5. Family c.1.17.1: NadC C-terminal domain-like [51691] (4 proteins)

6. Protein Putative nicotinate phosphoribosyltransferase EF2626 [141859] (1 species)
   includes extra C-terminal region that wraps around the N-terminal domain and contains an all-beta domain, this domain is distinct from but probably related to the Ta1145 extra domain

7. Species Enterococcus faecalis [TaxId:1351] [141860] (2 PDB entries)
   Uniprot Q830Y8 141-485

8. Domain d2f7fa1: 2f7f A:141-485 [133088]
   Other proteins in same PDB: d2f7fa2
   complexed with dpo, gol, nio, so4
   has additional subdomain(s) that are not in the common domain

Details for d2f7fa1

PDB Entry: 2f7f, 2 Å

PDB Description: crystal structure of enterococcus faecalis putative nicotinate phosphoribosyltransferase, new york structural genomics consortium

PDB Compounds: (A:) nicotinate phosphoribosyltransferase, putative

SCOPe Domain Sequences for d2f7fa1:

Sequence; same for both SEQRES and ATOM records:

>d2f7fa1 c.1.17.1 (A:141-485) Putative nicotinate phosphoribosyltransferase EF2626 {Enterococcus faecalis [TaxId: 1351]}
iatkaariksvigddpllefgtrraqeldaaiwgtraayiggadatsnvragkifgipvs
gthahslvqsygndyeafmayakthrdcvflvdtydtlkagvpsairvaremgdkinflg
vridsgdmayiskrvreqldeagfteakiyasndldentilnlkmqkskidvwgvgtkli
taydqpalgavfklvsiegedgqmkdtiklssnaekvttpgkkqvwritrksdkksegdy
vtlwnedprqeeeiymfhpvhtfinkyvrdfearpvlqdifvegkrvyelptldeikqya
kenldslheeykrdlnpqkypvdlstdcwnhkmnllekvrkdvkh

Timeline for d2f7fa1:

• d2f7fa1 first appeared in SCOP 1.73
  
• d2f7fa1 appears in SCOPe 2.07