![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) ![]() incomplete beta/alpha barrel with parallel beta-sheet of 7 strands |
![]() | Family c.1.17.1: NadC C-terminal domain-like [51691] (4 proteins) |
![]() | Protein Putative nicotinate phosphoribosyltransferase EF2626 [141859] (1 species) includes extra C-terminal region that wraps around the N-terminal domain and contains an all-beta domain, this domain is distinct from but probably related to the Ta1145 extra domain |
![]() | Species Enterococcus faecalis [TaxId:1351] [141860] (2 PDB entries) Uniprot Q830Y8 141-485 |
![]() | Domain d2f7fa1: 2f7f A:141-485 [133088] Other proteins in same PDB: d2f7fa2 complexed with dpo, gol, nio, so4 has additional subdomain(s) that are not in the common domain |
PDB Entry: 2f7f (more details), 2 Å
SCOPe Domain Sequences for d2f7fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f7fa1 c.1.17.1 (A:141-485) Putative nicotinate phosphoribosyltransferase EF2626 {Enterococcus faecalis [TaxId: 1351]} iatkaariksvigddpllefgtrraqeldaaiwgtraayiggadatsnvragkifgipvs gthahslvqsygndyeafmayakthrdcvflvdtydtlkagvpsairvaremgdkinflg vridsgdmayiskrvreqldeagfteakiyasndldentilnlkmqkskidvwgvgtkli taydqpalgavfklvsiegedgqmkdtiklssnaekvttpgkkqvwritrksdkksegdy vtlwnedprqeeeiymfhpvhtfinkyvrdfearpvlqdifvegkrvyelptldeikqya kenldslheeykrdlnpqkypvdlstdcwnhkmnllekvrkdvkh
Timeline for d2f7fa1: