Lineage for d2f7ee1 (2f7e E:15-350)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 874255Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 874256Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 874317Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 874422Protein cAMP-dependent PK, catalytic subunit [56116] (4 species)
    AGC group; PKA subfamily; serine/threonine kinase
  7. 874425Species Cow (Bos taurus) [TaxId:9913] [56118] (32 PDB entries)
    Uniprot P00517
  8. 874446Domain d2f7ee1: 2f7e E:15-350 [133087]
    automatically matched to d1q8ua_
    complexed with 2ea

Details for d2f7ee1

PDB Entry: 2f7e (more details), 2 Å

PDB Description: PKA complexed with (S)-2-(1H-Indol-3-yl)-1-(5-isoquinolin-6-yl-pyridin-3-yloxymethyl-etylamine
PDB Compounds: (E:) cAMP-dependent protein kinase, alpha-catalytic subunit

SCOP Domain Sequences for d2f7ee1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f7ee1 d.144.1.7 (E:15-350) cAMP-dependent PK, catalytic subunit {Cow (Bos taurus) [TaxId: 9913]}
vkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamkil
dkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlrr
igrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkgr
twtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgk
vrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveapf
ipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

SCOP Domain Coordinates for d2f7ee1:

Click to download the PDB-style file with coordinates for d2f7ee1.
(The format of our PDB-style files is described here.)

Timeline for d2f7ee1: