![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein cAMP-dependent PK, catalytic subunit [56116] (4 species) AGC group; PKA subfamily; serine/threonine kinase |
![]() | Species Cow (Bos taurus) [TaxId:9913] [56118] (31 PDB entries) |
![]() | Domain d2f7ee1: 2f7e E:15-350 [133087] automatically matched to d1q8ua_ complexed with 2ea |
PDB Entry: 2f7e (more details), 2 Å
SCOP Domain Sequences for d2f7ee1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f7ee1 d.144.1.7 (E:15-350) cAMP-dependent PK, catalytic subunit {Cow (Bos taurus) [TaxId: 9913]} vkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamkil dkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlrr igrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkgr twtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgk vrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveapf ipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
Timeline for d2f7ee1: