![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (16 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.1: Papain-like [54002] (25 proteins) |
![]() | Protein (Pro)cathepsin K [54028] (2 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [142845] (1 PDB entry) |
![]() | Domain d2f7da1: 2f7d A:1-211 [133086] complexed with noq; mutant |
PDB Entry: 2f7d (more details), 1.9 Å
SCOP Domain Sequences for d2f7da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f7da1 d.3.1.1 (A:1-211) (Pro)cathepsin K {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} tpdsidyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen dgcgggymtnafqyvqrnrgidsedaypyvgqdescmynptgkaakcrgyreipegneka lkravarvgpvsvaidasltsfqfyskgvyydencssdnlnhavlavgygiqkgnkhwii knswgeswgnkgyilmarnknnacgianlasfpkm
Timeline for d2f7da1: