Lineage for d2f7da1 (2f7d A:1-211)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2926591Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2926617Protein (Pro)cathepsin K [54028] (3 species)
  7. 2926689Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [142845] (1 PDB entry)
    Uniprot P43236 115-329
  8. 2926690Domain d2f7da1: 2f7d A:1-211 [133086]
    complexed with noq; mutant

Details for d2f7da1

PDB Entry: 2f7d (more details), 1.9 Å

PDB Description: a mutant rabbit cathepsin k with a nitrile inhibitor
PDB Compounds: (A:) cathepsin k

SCOPe Domain Sequences for d2f7da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f7da1 d.3.1.1 (A:1-211) (Pro)cathepsin K {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tpdsidyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
dgcgggymtnafqyvqrnrgidsedaypyvgqdescmynptgkaakcrgyreipegneka
lkravarvgpvsvaidasltsfqfyskgvyydencssdnlnhavlavgygiqkgnkhwii
knswgeswgnkgyilmarnknnacgianlasfpkm

SCOPe Domain Coordinates for d2f7da1:

Click to download the PDB-style file with coordinates for d2f7da1.
(The format of our PDB-style files is described here.)

Timeline for d2f7da1: