![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.61: Retroviral matrix proteins [47835] (1 superfamily) 4-5 helices; right-handed superhelix |
![]() | Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) ![]() the 5th, C-terminal helix is missing in some of the member structures |
![]() | Family a.61.1.3: Mason-Pfizer monkey virus matrix protein [47845] (1 protein) the C-terminal helix region is missing(?) automatically mapped to Pfam PF02337 |
![]() | Protein Mason-Pfizer monkey virus matrix protein [47846] (1 species) |
![]() | Species Simian Mason-Pfizer virus [TaxId:11855] [47847] (2 PDB entries) |
![]() | Domain d2f76x1: 2f76 X:1-94 [133085] automatically matched to d1bax__ |
PDB Entry: 2f76 (more details)
SCOPe Domain Sequences for d2f76x1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f76x1 a.61.1.3 (X:1-94) Mason-Pfizer monkey virus matrix protein {Simian Mason-Pfizer virus [TaxId: 11855]} mgqelsqheryveqlkqalktrgvkvkyadllkffdfvkdtcpwfpqegtidikrwrrvg dcfqdyyntfgpekvpvtafsywnlikelidkke
Timeline for d2f76x1: