Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species) |
Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (21 PDB entries) |
Domain d2f74d2: 2f74 D:3-180 [133083] Other proteins in same PDB: d2f74a1, d2f74b_, d2f74d1, d2f74e_ automatically matched to d1ddha2 |
PDB Entry: 2f74 (more details), 2.7 Å
SCOPe Domain Sequences for d2f74d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f74d2 d.19.1.1 (D:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]} hsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywer etqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegrd yialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
Timeline for d2f74d2:
View in 3D Domains from other chains: (mouse over for more information) d2f74a1, d2f74a2, d2f74b_, d2f74e_ |