Lineage for d2f74d1 (2f74 D:182-274)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2349424Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2349724Species Mouse (Mus musculus) [TaxId:10090] [88606] (110 PDB entries)
    Uniprot P01901 22-299
  8. 2349839Domain d2f74d1: 2f74 D:182-274 [133082]
    Other proteins in same PDB: d2f74a2, d2f74b2, d2f74b3, d2f74d2, d2f74e_
    automatically matched to d1ddha1

Details for d2f74d1

PDB Entry: 2f74 (more details), 2.7 Å

PDB Description: murine mhc class i h-2db in complex with human b2-microglobulin and lcmv-derived immunodminant peptide gp33
PDB Compounds: (D:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d2f74d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f74d1 b.1.1.2 (D:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw

SCOPe Domain Coordinates for d2f74d1:

Click to download the PDB-style file with coordinates for d2f74d1.
(The format of our PDB-style files is described here.)

Timeline for d2f74d1: