Class b: All beta proteins [48724] (165 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (8 families) bind hydrophobic ligands in their interior |
Family b.60.1.2: Fatty acid binding protein-like [50847] (17 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
Protein Liver fatty acid binding protein [50866] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [141464] (1 PDB entry) |
Domain d2f73f1: 2f73 F:1-127 [133076] automatically matched to 2F73 A:1-127 |
PDB Entry: 2f73 (more details), 2.5 Å
SCOP Domain Sequences for d2f73f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f73f1 b.60.1.2 (F:1-127) Liver fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]} msfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkftitagskviq neftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitntmtlgdivf kriskri
Timeline for d2f73f1: