SCOPe 2.03: Domain d2f73c_: 2f73 C:

Lineage for d2f73c_ (2f73 C:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Liver fatty acid binding protein [50866] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141464] (15 PDB entries)
   Uniprot P07148 1-127

8. Domain d2f73c_: 2f73 C: [133073]
   automated match to d2f73a1

Details for d2f73c_

PDB Entry: 2f73, 2.5 Å

PDB Description: Crystal structure of human fatty acid binding protein 1 (FABP1)

PDB Compounds: (C:) Fatty acid-binding protein, liver

SCOPe Domain Sequences for d2f73c_:

Sequence; same for both SEQRES and ATOM records:

>d2f73c_ b.60.1.2 (C:) Liver fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]}
tenlyfqsmsfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkfti
tagskviqneftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitnt
mtlgdivfkriskri

Timeline for d2f73c_:

• d2f73c_ first appeared in SCOP 1.73, called d2f73c1
  
• d2f73c_ was called d2f73c1 in SCOPe 2.02
  
• d2f73c_ appears in SCOPe 2.04
  
• d2f73c_ appears in the current release, SCOPe 2.08, called d2f73c2