Lineage for d2f73b1 (2f73 B:1-127)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 673645Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 673646Superfamily b.60.1: Lipocalins [50814] (8 families) (S)
    bind hydrophobic ligands in their interior
  5. 673924Family b.60.1.2: Fatty acid binding protein-like [50847] (17 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 674056Protein Liver fatty acid binding protein [50866] (2 species)
  7. 674057Species Human (Homo sapiens) [TaxId:9606] [141464] (1 PDB entry)
  8. 674059Domain d2f73b1: 2f73 B:1-127 [133072]
    automatically matched to 2F73 A:1-127

Details for d2f73b1

PDB Entry: 2f73 (more details), 2.5 Å

PDB Description: Crystal structure of human fatty acid binding protein 1 (FABP1)
PDB Compounds: (B:) Fatty acid-binding protein, liver

SCOP Domain Sequences for d2f73b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f73b1 b.60.1.2 (B:1-127) Liver fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]}
msfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkftitagskviq
neftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitntmtlgdivf
kriskri

SCOP Domain Coordinates for d2f73b1:

Click to download the PDB-style file with coordinates for d2f73b1.
(The format of our PDB-style files is described here.)

Timeline for d2f73b1: