Lineage for d2f6ya1 (2f6y A:2-298)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 833132Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 833133Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (5 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 833183Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (6 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 833215Protein Tyrosine phosphatase [52806] (7 species)
  7. 833216Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (91 PDB entries)
    Uniprot P18031 2-300
    Uniprot P18031 1-298
    Uniprot P18031 2-299
    Uniprot P18031 2-300 ! Uniprot P18031 1-298 ! Uniprot P18031 2-299
  8. 833240Domain d2f6ya1: 2f6y A:2-298 [133067]
    automatically matched to d1q1ma_
    complexed with cl, ent, mg

Details for d2f6ya1

PDB Entry: 2f6y (more details), 2.15 Å

PDB Description: Protein tyrosine phosphatase 1B with sulfamic acid inhibitors
PDB Compounds: (A:) Tyrosine-protein phosphatase, non-receptor type 1

SCOP Domain Sequences for d2f6ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f6ya1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed

SCOP Domain Coordinates for d2f6ya1:

Click to download the PDB-style file with coordinates for d2f6ya1.
(The format of our PDB-style files is described here.)

Timeline for d2f6ya1: