Lineage for d2f6ta_ (2f6t A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875255Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 2875300Protein Tyrosine phosphatase [52806] (7 species)
  7. 2875301Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (268 PDB entries)
    Uniprot P18031 2-300 ! Uniprot P18031 1-298 ! Uniprot P18031 2-299
  8. 2875306Domain d2f6ta_: 2f6t A: [133060]
    automated match to d1t48a_
    complexed with 1c2, cl, mg

Details for d2f6ta_

PDB Entry: 2f6t (more details), 1.7 Å

PDB Description: Protein tyrosine phosphatase 1B with sulfamic acid inhibitors
PDB Compounds: (A:) Tyrosine-protein phosphatase, non-receptor type 1

SCOPe Domain Sequences for d2f6ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f6ta_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed

SCOPe Domain Coordinates for d2f6ta_:

Click to download the PDB-style file with coordinates for d2f6ta_.
(The format of our PDB-style files is described here.)

Timeline for d2f6ta_: