SCOP 1.75: Domain d2f6sb1: 2f6s B:1-177

Lineage for d2f6sb1 (2f6s B:1-177)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.265: Fic-like [140930] (1 superfamily)
   multihelical; one central helix is surrounded by seven helices

4. Superfamily a.265.1: Fic-like [140931] (1 family)

5. Family a.265.1.1: Fic-like [140932] (2 proteins)
   Pfam PF02661; the conserved motif HPFXXGNG is at the N-terminus of the central helix

6. Protein Cell filamentation protein Fic [140933] (1 species)

7. Species Helicobacter pylori [TaxId:210] [140934] (1 PDB entry)
   Uniprot O25774 1-177

8. Domain d2f6sb1: 2f6s B:1-177 [133059]
   automatically matched to 2F6S A:1-177
   complexed with po4, zn

Details for d2f6sb1

PDB Entry: 2f6s, 2.5 Å

PDB Description: structure of cell filamentation protein (fic) from helicobacter pylori

PDB Compounds: (B:) cell filamentation protein, putative

SCOP Domain Sequences for d2f6sb1:

Sequence; same for both SEQRES and ATOM records:

>d2f6sb1 a.265.1.1 (B:1-177) Cell filamentation protein Fic {Helicobacter pylori [TaxId: 210]}
mhldrqslekakhliqsglidtievgtikglqeihrflfeglyefagkirdkniakgnfr
fanclyldlilpriesmpqnnfnqivekyvemniahpflegngratriwldlllkkelkk
ivlwdridkaaylsamerspvndleiktllkkhlssntndpltlikgitqsyyyegl

Timeline for d2f6sb1:

• d2f6sb1 first appeared in SCOP 1.73
  
• d2f6sb1 appears in SCOPe 2.01
  
• d2f6sb1 appears in the current release, SCOPe 2.08, called d2f6sb2