SCOPe 2.05: Domain d2f6md_: 2f6m D:

Lineage for d2f6md_ (2f6m D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.17: Endosomal sorting complex assembly domain [140111] (3 families)
   forms 'fan'-like heterooligomers, in which the domains of different subunit make similar interactions at the tip of the hairpin

5. Family a.2.17.2: VPS28 N-terminal domain [140115] (2 proteins)
   includes structurally variable linker region

6. Protein Vacuolar protein sorting-associated protein 28, VPS28 [140116] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140117] (3 PDB entries)
   Uniprot Q02767 15-125! Uniprot Q02767 23-123

8. Domain d2f6md_: 2f6m D: [133054]
   Other proteins in same PDB: d2f6ma_, d2f6mc_
   automated match to d2f6mb1
   complexed with ddq, mg

Details for d2f6md_

PDB Entry: 2f6m, 2.1 Å

PDB Description: structure of a vps23-c:vps28-n subcomplex

PDB Compounds: (D:) vacuolar protein sorting-associated protein vps28

SCOPe Domain Sequences for d2f6md_:

Sequence; same for both SEQRES and ATOM records:

>d2f6md_ a.2.17.2 (D:) Vacuolar protein sorting-associated protein 28, VPS28 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qlfhdevplfdnsitskdkevietlseiysivitldhvekaylkdsiddtqytntvdkll
kqfkvylnsqnkeeinkhfqsieafadtynitasnaitrler

Timeline for d2f6md_:

• d2f6md_ first appeared in SCOP 1.73, called d2f6md1
  
• d2f6md_ appears in SCOPe 2.04
  
• d2f6md_ appears in SCOPe 2.06
  
• d2f6md_ appears in the current release, SCOPe 2.08