Lineage for d2f6mc1 (2f6m C:322-383)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 633305Fold a.2: Long alpha-hairpin [46556] (19 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 633776Superfamily a.2.17: Endosomal sorting complex assembly domain [140111] (3 families) (S)
    forms 'fan'-like heterooligomers, in which the domains of different subunit make similar interactions at the tip of the hairpin
  5. 633777Family a.2.17.1: VPS23 C-terminal domain [140112] (1 protein)
  6. 633778Protein Vacuolar protein sorting-associated protein 23, VPS23 [140113] (1 species)
  7. 633779Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140114] (3 PDB entries)
  8. 633781Domain d2f6mc1: 2f6m C:322-383 [133053]
    Other proteins in same PDB: d2f6mb1, d2f6md1
    automatically matched to 2F66 A:322-385
    complexed with ddq, mg; mutant

Details for d2f6mc1

PDB Entry: 2f6m (more details), 2.1 Å

PDB Description: structure of a vps23-c:vps28-n subcomplex
PDB Compounds: (C:) suppressor protein stp22 of temperature-sensitive alpha-factor receptor and arginine permease

SCOP Domain Sequences for d2f6mc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f6mc1 a.2.17.1 (C:322-383) Vacuolar protein sorting-associated protein 23, VPS23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tdglnqlynlvaqdyaltdtiealsrmlhrgtipldtfvkqgrelarqqflvrwhiqrit
sp

SCOP Domain Coordinates for d2f6mc1:

Click to download the PDB-style file with coordinates for d2f6mc1.
(The format of our PDB-style files is described here.)

Timeline for d2f6mc1: