SCOP 1.73: Domain d2f6ma1: 2f6m A:322-385

Lineage for d2f6ma1 (2f6m A:322-385)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.2: Long alpha-hairpin [46556] (19 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.17: Endosomal sorting complex assembly domain [140111] (3 families)
   forms 'fan'-like heterooligomers, in which the domains of different subunit make similar interactions at the tip of the hairpin

5. Family a.2.17.1: VPS23 C-terminal domain [140112] (1 protein)

6. Protein Vacuolar protein sorting-associated protein 23, VPS23 [140113] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140114] (3 PDB entries)

8. Domain d2f6ma1: 2f6m A:322-385 [133051]
   Other proteins in same PDB: d2f6mb1, d2f6md1
   automatically matched to 2F66 A:322-385
   complexed with ddq, mg; mutant

Details for d2f6ma1

PDB Entry: 2f6m, 2.1 Å

PDB Description: structure of a vps23-c:vps28-n subcomplex

PDB Compounds: (A:) suppressor protein stp22 of temperature-sensitive alpha-factor receptor and arginine permease

SCOP Domain Sequences for d2f6ma1:

Sequence; same for both SEQRES and ATOM records:

>d2f6ma1 a.2.17.1 (A:322-385) Vacuolar protein sorting-associated protein 23, VPS23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tdglnqlynlvaqdyaltdtiealsrmlhrgtipldtfvkqgrelarqqflvrwhiqrit
spls

Timeline for d2f6ma1:

• d2f6ma1 is new in SCOP 1.73
  
• d2f6ma1 appears in SCOP 1.75
  
• d2f6ma1 appears in the current release, SCOPe 2.08, called d2f6ma2