Class a: All alpha proteins [46456] (290 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.17: Endosomal sorting complex assembly domain [140111] (4 families) forms 'fan'-like heterooligomers, in which the domains of different subunit make similar interactions at the tip of the hairpin |
Family a.2.17.1: VPS23 C-terminal domain [140112] (1 protein) automatically mapped to Pfam PF09454 |
Protein Vacuolar protein sorting-associated protein 23, VPS23 [140113] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140114] (3 PDB entries) Uniprot P25604 322-385! Uniprot P25604 325-383 |
Domain d2f6ma2: 2f6m A:322-385 [133051] Other proteins in same PDB: d2f6ma3, d2f6mb2, d2f6mb3, d2f6mc3, d2f6md_ automated match to d2f66a1 complexed with ddq, mg |
PDB Entry: 2f6m (more details), 2.1 Å
SCOPe Domain Sequences for d2f6ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f6ma2 a.2.17.1 (A:322-385) Vacuolar protein sorting-associated protein 23, VPS23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tdglnqlynlvaqdyaltdtiealsrmlhrgtipldtfvkqgrelarqqflvrwhiqrit spls
Timeline for d2f6ma2: