Lineage for d2f6lb_ (2f6l B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015221Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 2015222Superfamily a.130.1: Chorismate mutase II [48600] (5 families) (S)
  5. 2015273Family a.130.1.4: Secreted chorismate mutase-like [140945] (1 protein)
    duplication; two structural repeats, like in the yeast enzyme, but with a different location of the remaining active site
  6. 2015274Protein Secreted chorismate mutase [140946] (1 species)
  7. 2015275Species Mycobacterium tuberculosis [TaxId:1773] [140947] (4 PDB entries)
    Uniprot O07746 34-199
  8. 2015281Domain d2f6lb_: 2f6l B: [133050]
    automated match to d2f6la1

Details for d2f6lb_

PDB Entry: 2f6l (more details), 1.7 Å

PDB Description: x-ray structure of chorismate mutase from mycobacterium tuberculosis
PDB Compounds: (B:) chorismate mutase

SCOPe Domain Sequences for d2f6lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f6lb_ a.130.1.4 (B:) Secreted chorismate mutase {Mycobacterium tuberculosis [TaxId: 1773]}
tsqlaelvdaaaerlevadpvaafkwraqlpiedsgrveqqlaklgedarsqhidpdyvt
rvfddqirateaieysrfsdwklnpasappeppdlsasrsaidslnnrmlsqiwshwsll
sapscaaqldrakrdivrsrhldslyqralttatqsycqalppa

SCOPe Domain Coordinates for d2f6lb_:

Click to download the PDB-style file with coordinates for d2f6lb_.
(The format of our PDB-style files is described here.)

Timeline for d2f6lb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2f6la1