Lineage for d2f6lb1 (2f6l B:36-199)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777702Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 777703Superfamily a.130.1: Chorismate mutase II [48600] (4 families) (S)
  5. 777739Family a.130.1.4: Secreted chorismate mutase-like [140945] (1 protein)
    duplication; two structural repeats, like in the yeast enzyme, but with a different location of the remaining active site
  6. 777740Protein Secreted chorismate mutase [140946] (1 species)
  7. 777741Species Mycobacterium tuberculosis [TaxId:1773] [140947] (4 PDB entries)
    Uniprot O07746 34-199
  8. 777747Domain d2f6lb1: 2f6l B:36-199 [133050]
    automatically matched to 2F6L A:34-199

Details for d2f6lb1

PDB Entry: 2f6l (more details), 1.7 Å

PDB Description: x-ray structure of chorismate mutase from mycobacterium tuberculosis
PDB Compounds: (B:) chorismate mutase

SCOP Domain Sequences for d2f6lb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f6lb1 a.130.1.4 (B:36-199) Secreted chorismate mutase {Mycobacterium tuberculosis [TaxId: 1773]}
tsqlaelvdaaaerlevadpvaafkwraqlpiedsgrveqqlaklgedarsqhidpdyvt
rvfddqirateaieysrfsdwklnpasappeppdlsasrsaidslnnrmlsqiwshwsll
sapscaaqldrakrdivrsrhldslyqralttatqsycqalppa

SCOP Domain Coordinates for d2f6lb1:

Click to download the PDB-style file with coordinates for d2f6lb1.
(The format of our PDB-style files is described here.)

Timeline for d2f6lb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2f6la1