Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.15: PP1699/LP2961-like [141819] (6 proteins) Pfam PF04909; Amidohydrolase; stand-alone domain |
Protein Putative amidohydrolase LP2961 [141828] (1 species) |
Species Lactobacillus plantarum [TaxId:1590] [141829] (1 PDB entry) Uniprot Q88TJ2 2-307 |
Domain d2f6kb_: 2f6k B: [133048] automated match to d2f6ka1 complexed with mn |
PDB Entry: 2f6k (more details), 2.5 Å
SCOPe Domain Sequences for d2f6kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f6kb_ c.1.9.15 (B:) Putative amidohydrolase LP2961 {Lactobacillus plantarum [TaxId: 1590]} skidfhthylptsyvealkrhvpgdpdgwptpewtpqltlnfmrdndisysilslssphv nfgdkaetirlveaanddgkslaqqypdqlgylaslpipyeldavktvqqaldqdgalgv tvptnsrglyfgspvlervyqeldarqaivalhpnepailpknvdidlpvpllgffmdtt mtfinmlkyhffekypnikviiphagaflgivddriaqyaqkvyqvdvydvmhhvyfdva gavlprqlptlmslaqpehllygsdipytpldgsrqlghalattdlltneqkqaifydna hrllte
Timeline for d2f6kb_: