SCOP 1.73: Domain d2f6ka1: 2f6k A:2-307

Lineage for d2f6ka1 (2f6k A:2-307)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (15 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.15: PP1699/LP2961-like [141819] (5 proteins)
   Pfam PF04909; Amidohydrolase; stand-alone domain

6. Protein Putative amidohydrolase LP2961 [141828] (1 species)

7. Species Lactobacillus plantarum [TaxId:1590] [141829] (1 PDB entry)

8. Domain d2f6ka1: 2f6k A:2-307 [133047]
   complexed with mn

Details for d2f6ka1

PDB Entry: 2f6k, 2.5 Å

PDB Description: crystal structure of amidohydrorolase ii; northeast structural genomics target lpr24

PDB Compounds: (A:) metal-dependent hydrolase

SCOP Domain Sequences for d2f6ka1:

Sequence; same for both SEQRES and ATOM records:

>d2f6ka1 c.1.9.15 (A:2-307) Putative amidohydrolase LP2961 {Lactobacillus plantarum [TaxId: 1590]}
skidfhthylptsyvealkrhvpgdpdgwptpewtpqltlnfmrdndisysilslssphv
nfgdkaetirlveaanddgkslaqqypdqlgylaslpipyeldavktvqqaldqdgalgv
tvptnsrglyfgspvlervyqeldarqaivalhpnepailpknvdidlpvpllgffmdtt
mtfinmlkyhffekypnikviiphagaflgivddriaqyaqkvyqvdvydvmhhvyfdva
gavlprqlptlmslaqpehllygsdipytpldgsrqlghalattdlltneqkqaifydna
hrllte

Timeline for d2f6ka1:

• d2f6ka1 is new in SCOP 1.73
  
• d2f6ka1 appears in SCOP 1.75
  
• d2f6ka1 appears in the current release, SCOPe 2.08