Lineage for d2f6ie2 (2f6i E:179-365)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2099100Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 protein domains)
    automatically mapped to Pfam PF00574
  6. 2099101Protein Clp protease, ClpP subunit [52098] (9 species)
  7. 2099212Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [141996] (1 PDB entry)
    Uniprot O97252 177-366
  8. 2099217Domain d2f6ie2: 2f6i E:179-365 [133044]
    Other proteins in same PDB: d2f6ia2, d2f6ib3, d2f6ic3, d2f6id3, d2f6ie3, d2f6if3, d2f6ig3
    automated match to d2f6ia1

Details for d2f6ie2

PDB Entry: 2f6i (more details), 2.45 Å

PDB Description: Crystal structure of the ClpP protease catalytic domain from Plasmodium falciparum
PDB Compounds: (E:) ATP-dependent CLP protease, putative

SCOPe Domain Sequences for d2f6ie2:

Sequence, based on SEQRES records: (download)

>d2f6ie2 c.14.1.1 (E:179-365) Clp protease, ClpP subunit {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
dikdmkkdvklfffkkriiyltdeinkktadelisqllyldninhndikiyinspggsin
eglaildifnyiksdiqtisfglvasmasvilasgkkgkrkslpncrimihqplgnafgh
pqdieiqtkeilylkkllyhylssftnqtvetiekdsdrdyymnaleakqygiideviet
klphpyf

Sequence, based on observed residues (ATOM records): (download)

>d2f6ie2 c.14.1.1 (E:179-365) Clp protease, ClpP subunit {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
dikdmkkdvklfffkkriiyltdeinkktadelisqllyldninhndikiyinspggsin
eglaildifnyiksdiqtisfglvasmasvilasgkkgkrkslpncrimihiqtkeilyl
kkllyhylssftnqtvetiekdsdrdyymnaleakqygiidevietklphpyf

SCOPe Domain Coordinates for d2f6ie2:

Click to download the PDB-style file with coordinates for d2f6ie2.
(The format of our PDB-style files is described here.)

Timeline for d2f6ie2: