Lineage for d2f6da1 (2f6d A:1-492)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 645795Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 645796Superfamily a.102.1: Six-hairpin glycosidases [48208] (7 families) (S)
  5. 645797Family a.102.1.1: Glucoamylase [48209] (1 protein)
  6. 645798Protein Glucoamylase [48210] (2 species)
  7. 645806Species Yeast (Saccharomycopsis fibuligera) [TaxId:4944] [48212] (3 PDB entries)
  8. 645808Domain d2f6da1: 2f6d A:1-492 [133039]
    automatically matched to d1ayx__
    complexed with acr, na, po4

Details for d2f6da1

PDB Entry: 2f6d (more details), 1.6 Å

PDB Description: structure of the complex of a glucoamylase from saccharomycopsis fibuligera with acarbose
PDB Compounds: (A:) Glucoamylase GLU1

SCOP Domain Sequences for d2f6da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f6da1 a.102.1.1 (A:1-492) Glucoamylase {Yeast (Saccharomycopsis fibuligera) [TaxId: 4944]}
aypsfeaysnykvdrtdletfldkqkevslyyllqniaypegqfnngvpgtviaspstsn
pdyyyqwtrdsaitfltvlselednnfnttlakaveyyintsynlqrtsnpsgsfddenh
kglgepkfntdgsaytgawgrpqndgpalrayaisrylndvnslnegklvltdsgdinfs
stediykniikpdleyvigywdstgfdlweenqgrhfftslvqqkalayavdiaksfddg
dfantlsstastlesylsgsdggfvntdvnhivenpdllqqnsrqgldsatyigpllthd
igessstpfdvdneyvlqsyylllednkdrysvnsaysagaaigrypedvyngdgssegn
pwflatayaaqvpyklaydaksasnditinkinydffnkyivdlstinsayqssdsvtik
sgsdefntvadnlvtfgdsflqvildhinddgslneqlnrytgystgaysltwssgalle
airlrnkvkala

SCOP Domain Coordinates for d2f6da1:

Click to download the PDB-style file with coordinates for d2f6da1.
(The format of our PDB-style files is described here.)

Timeline for d2f6da1: