Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) N-terminal domain is beta/beta/alpha common fold |
Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins) |
Protein Pyranose 2-oxidase [117843] (1 species) |
Species White-rot fungus (Peniophora sp. SG) [TaxId:204723] [117844] (5 PDB entries) |
Domain d2f6ca2: 2f6c A:355-552 [133038] Other proteins in same PDB: d2f6ca1 automatically matched to d1tzla2 complexed with fad, peg, pg4; mutant |
PDB Entry: 2f6c (more details), 1.84 Å
SCOP Domain Sequences for d2f6ca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f6ca2 d.16.1.1 (A:355-552) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} yiteqslvfcqtvmstelidsvksdmtirgtpgeltysvtytpgastnkhpdwwnekvkn hmmqhqedplpipfedpepqvttlfqpshpwhtqihrdafsygavqqsidsrlivdwrff grtepkeenklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdmcvmsakiggflp gslpqfmkpglvlhlggt
Timeline for d2f6ca2: