SCOPe 2.08: Domain d2f6ca2: 2f6c A:355-552

Lineage for d2f6ca2 (2f6c A:355-552)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins)

6. Protein Pyranose 2-oxidase [117843] (1 species)

7. Species White-rot fungus (Peniophora sp. SG) [TaxId:204723] [117844] (5 PDB entries)
   Uniprot Q8J136 43-619

8. Domain d2f6ca2: 2f6c A:355-552 [133038]
   Other proteins in same PDB: d2f6ca1
   automatically matched to d1tzla2
   complexed with fad, peg, pg4; mutant

Details for d2f6ca2

PDB Entry: 2f6c, 1.84 Å

PDB Description: reaction geometry and thermostability of pyranose 2-oxidase from the white-rot fungus peniophora sp., thermostability mutant e542k

PDB Compounds: (A:) Pyranose 2-oxidase

SCOPe Domain Sequences for d2f6ca2:

Sequence; same for both SEQRES and ATOM records:

>d2f6ca2 d.16.1.1 (A:355-552) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]}
yiteqslvfcqtvmstelidsvksdmtirgtpgeltysvtytpgastnkhpdwwnekvkn
hmmqhqedplpipfedpepqvttlfqpshpwhtqihrdafsygavqqsidsrlivdwrff
grtepkeenklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdmcvmsakiggflp
gslpqfmkpglvlhlggt

Timeline for d2f6ca2:

• d2f6ca2 first appeared in SCOP 1.73
  
• d2f6ca2 appears in SCOPe 2.07