![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
![]() | Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) ![]() |
![]() | Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins) C-terminal domain is alpha+beta is common for the family |
![]() | Protein Pyranose 2-oxidase [117439] (1 species) |
![]() | Species White-rot fungus (Peniophora sp. SG) [TaxId:204723] [117440] (5 PDB entries) Uniprot Q8J136 43-619 |
![]() | Domain d2f6ca1: 2f6c A:43-354,A:553-619 [133037] Other proteins in same PDB: d2f6ca2 automatically matched to d1tzla1 complexed with fad, peg, pg4; mutant |
PDB Entry: 2f6c (more details), 1.84 Å
SCOPe Domain Sequences for d2f6ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f6ca1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} mdikydvvivgsgpigctyarelvgagykvamfdigeidsglkigahkkntveyqknidk fvnviqgqlmsvsvpvntlvvdtlsptswqastffvrngsnpeqdplrnlsgqavtrvvg gmsthwtcatprfdreqrpllvkddadaddaewdrlytkaesyfqtgtdqfkesirhnlv lnklaeeykgqrdfqqiplaatrrsptfvewssantvfdlqnrpntdapeerfnlfpava cervvrnalnseieslhihdlisgdrfeikadvyvltagavhntqllvnsgfgqlgrpnp tnppellpslgsXhrmgfdekednccvntdsrvfgfknlflggcgniptayganptltam slaiksceyikqnftpspft
Timeline for d2f6ca1: