Lineage for d2f69a2 (2f69 A:194-364)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 811032Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 811316Superfamily b.85.7: SET domain [82199] (3 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
  5. 811317Family b.85.7.1: Histone lysine methyltransferases [82200] (3 proteins)
    contains metal-binding preSET and postSET domains
  6. 811323Protein Histone H3 K4-specific methyltransferase SET7/9 catalytic domain [82205] (1 species)
  7. 811324Species Human (Homo sapiens) [TaxId:9606] [82206] (11 PDB entries)
    Uniprot Q8WTS6 52-336
  8. 811325Domain d2f69a2: 2f69 A:194-364 [133036]
    Other proteins in same PDB: d2f69a1
    automatically matched to d1o9sa2
    complexed with ace, mlz, sah

Details for d2f69a2

PDB Entry: 2f69 (more details), 1.3 Å

PDB Description: Ternary complex of SET7/9 bound to AdoHcy and a TAF10 peptide
PDB Compounds: (A:) Histone-lysine N-methyltransferase, H3 lysine-4 specific SET7

SCOP Domain Sequences for d2f69a2:

Sequence, based on SEQRES records: (download)

>d2f69a2 b.85.7.1 (A:194-364) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygydhsppgksgpeapewyqvelkafqatq

Sequence, based on observed residues (ATOM records): (download)

>d2f69a2 b.85.7.1 (A:194-364) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygydhsppeapewyqvelkafqatq

SCOP Domain Coordinates for d2f69a2:

Click to download the PDB-style file with coordinates for d2f69a2.
(The format of our PDB-style files is described here.)

Timeline for d2f69a2: