SCOPe 2.08: Domain d2f69a2: 2f69 A:194-364

Lineage for d2f69a2 (2f69 A:194-364)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.7: SET domain [82199] (4 families)
   duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
   also contains a substrate-binding alpha+beta subdomain inserted in the core
   Pfam PF00856

5. Family b.85.7.1: Histone lysine methyltransferases [82200] (3 proteins)
   contains metal-binding preSET (Pfam PF05033) or AWS (Associated With SET, Pfam PF17907), and postSET domains

6. Protein Histone H3 K4-specific methyltransferase SET7/9 catalytic domain [82205] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82206] (19 PDB entries)
   Uniprot Q8WTS6 52-336

8. Domain d2f69a2: 2f69 A:194-364 [133036]
   Other proteins in same PDB: d2f69a1
   automatically matched to d1o9sa2
   complexed with sah

Details for d2f69a2

PDB Entry: 2f69, 1.3 Å

PDB Description: Ternary complex of SET7/9 bound to AdoHcy and a TAF10 peptide

PDB Compounds: (A:) Histone-lysine N-methyltransferase, H3 lysine-4 specific SET7

SCOPe Domain Sequences for d2f69a2:

Sequence, based on SEQRES records:

>d2f69a2 b.85.7.1 (A:194-364) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygydhsppgksgpeapewyqvelkafqatq

Sequence, based on observed residues (ATOM records):

>d2f69a2 b.85.7.1 (A:194-364) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygydhsppeapewyqvelkafqatq

Timeline for d2f69a2:

• d2f69a2 first appeared in SCOP 1.73
  
• d2f69a2 appears in SCOPe 2.07