SCOP 1.75: Domain d2f69a1: 2f69 A:116-193

Lineage for d2f69a1 (2f69 A:116-193)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
   single sheet formed by beta-hairpin repeats; exposed on both sides in the middle

4. Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family)
   11+ stranded sheet partly folded upon itself at the C-end

5. Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein)

6. Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82188] (11 PDB entries)
   Uniprot Q8WTS6 52-366

8. Domain d2f69a1: 2f69 A:116-193 [133035]
   Other proteins in same PDB: d2f69a2
   automatically matched to d1n6aa1
   complexed with ace, mlz, sah

Details for d2f69a1

PDB Entry: 2f69, 1.3 Å

PDB Description: Ternary complex of SET7/9 bound to AdoHcy and a TAF10 peptide

PDB Compounds: (A:) Histone-lysine N-methyltransferase, H3 lysine-4 specific SET7

SCOP Domain Sequences for d2f69a1:

Sequence; same for both SEQRES and ATOM records:

>d2f69a1 b.76.2.1 (A:116-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
hgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmst
eegrphfelmpgnsvyhf

Timeline for d2f69a1:

• d2f69a1 first appeared in SCOP 1.73
  
• d2f69a1 appears in SCOPe 2.01
  
• d2f69a1 appears in the current release, SCOPe 2.08